Placeholder image of a protein
Icon representing a puzzle

2125: Revisiting Puzzle 126: Ethanolamine Utilization

Closed since 6 months ago

Novice Overall Prediction

Summary


Created
March 24, 2022
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.



Sequence:


MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,877
  2. Avatar for Contenders 2. Contenders 76 pts. 10,777
  3. Avatar for Go Science 3. Go Science 56 pts. 10,720
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,489
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,455
  6. Avatar for Gargleblasters 6. Gargleblasters 20 pts. 10,130
  7. Avatar for AlphaFold 7. AlphaFold 14 pts. 9,872
  8. Avatar for Beta Folders 8. Beta Folders 9 pts. 9,777
  9. Avatar for Coastal Biochemistry 9. Coastal Biochemistry 6 pts. 9,418
  10. Avatar for Australia 10. Australia 4 pts. 9,371

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,877
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 97 pts. 10,777
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 94 pts. 10,715
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 90 pts. 10,682
  5. Avatar for Sandrix72 5. Sandrix72 Lv 1 87 pts. 10,628
  6. Avatar for NPrincipi 6. NPrincipi Lv 1 84 pts. 10,612
  7. Avatar for georg137 7. georg137 Lv 1 81 pts. 10,605
  8. Avatar for grogar7 8. grogar7 Lv 1 78 pts. 10,599
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 75 pts. 10,598
  10. Avatar for g_b 10. g_b Lv 1 72 pts. 10,541

Comments