Placeholder image of a protein
Icon representing a puzzle

2075: Revisiting Puzzle 91: Virus Protein

Closed since 10 months ago

Novice Overall Prediction

Summary


Created
November 25, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,489
  2. Avatar for Gargleblasters 2. Gargleblasters 77 pts. 10,468
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,462
  4. Avatar for Go Science 4. Go Science 43 pts. 10,408
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 10,349
  6. Avatar for Contenders 6. Contenders 22 pts. 10,277
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,229
  8. Avatar for AlphaFold 8. AlphaFold 11 pts. 9,798
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 9,394
  10. Avatar for Australia 10. Australia 5 pts. 9,366

  1. Avatar for grogar7
    1. grogar7 Lv 1
    100 pts. 10,482
  2. Avatar for Skippysk8s 2. Skippysk8s Lv 1 97 pts. 10,468
  3. Avatar for LociOiling 3. LociOiling Lv 1 93 pts. 10,461
  4. Avatar for gmn 4. gmn Lv 1 90 pts. 10,427
  5. Avatar for NinjaGreg 5. NinjaGreg Lv 1 87 pts. 10,408
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 83 pts. 10,401
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 80 pts. 10,356
  8. Avatar for phi16 8. phi16 Lv 1 77 pts. 10,353
  9. Avatar for frood66 9. frood66 Lv 1 74 pts. 10,335
  10. Avatar for Galaxie 10. Galaxie Lv 1 72 pts. 10,293

Comments