Placeholder image of a protein
Icon representing a puzzle

2048: Revisiting Puzzle 83: Cardiotoxin

Closed since about 1 year ago

Novice Overall Prediction

Summary


Created
September 23, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,428
  2. Avatar for Gargleblasters 2. Gargleblasters 76 pts. 10,376
  3. Avatar for Go Science 3. Go Science 56 pts. 10,336
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 41 pts. 10,316
  5. Avatar for Marvin's bunch 5. Marvin's bunch 29 pts. 10,218
  6. Avatar for Contenders 6. Contenders 20 pts. 10,140
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 14 pts. 10,105
  8. Avatar for Australia 8. Australia 9 pts. 9,260
  9. Avatar for BOINC@Poland 9. BOINC@Poland 6 pts. 9,069
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 4 pts. 8,932

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,427
  2. Avatar for Enzyme 2. Enzyme Lv 1 97 pts. 10,376
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 93 pts. 10,336
  4. Avatar for silent gene 4. silent gene Lv 1 90 pts. 10,268
  5. Avatar for gmn 5. gmn Lv 1 87 pts. 10,266
  6. Avatar for dcrwheeler 6. dcrwheeler Lv 1 84 pts. 10,247
  7. Avatar for NinjaGreg 7. NinjaGreg Lv 1 80 pts. 10,237
  8. Avatar for Angus 8. Angus Lv 1 77 pts. 10,216
  9. Avatar for Lotus23 9. Lotus23 Lv 1 75 pts. 10,208
  10. Avatar for grogar7 10. grogar7 Lv 1 72 pts. 10,196

Comments