Placeholder image of a protein
Icon representing a puzzle

1970: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
March 18, 2021
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Go Science 100 pts. 10,136
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 10,134
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 49 pts. 10,016
  4. Avatar for Beta Folders 4. Beta Folders 33 pts. 10,010
  5. Avatar for Marvin's bunch 5. Marvin's bunch 22 pts. 10,003
  6. Avatar for Gargleblasters 6. Gargleblasters 14 pts. 9,888
  7. Avatar for Italiani Al Lavoro 7. Italiani Al Lavoro 8 pts. 9,798
  8. Avatar for Contenders 8. Contenders 5 pts. 9,730
  9. Avatar for Team China 9. Team China 3 pts. 9,657
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 9,656

  1. Avatar for Galaxie
    1. Galaxie Lv 1
    100 pts. 10,131
  2. Avatar for g_b 2. g_b Lv 1 97 pts. 10,127
  3. Avatar for Phyx 3. Phyx Lv 1 94 pts. 10,117
  4. Avatar for ichwilldiesennamen 4. ichwilldiesennamen Lv 1 91 pts. 10,109
  5. Avatar for akaaka 5. akaaka Lv 1 88 pts. 10,107
  6. Avatar for NinjaGreg 6. NinjaGreg Lv 1 85 pts. 10,107
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 82 pts. 10,099
  8. Avatar for mirp 8. mirp Lv 1 79 pts. 10,093
  9. Avatar for grogar7 9. grogar7 Lv 1 76 pts. 10,071
  10. Avatar for robgee 10. robgee Lv 1 74 pts. 10,062

Comments