Placeholder image of a protein
Icon representing a puzzle

1857: Refinement Puzzle: R1029

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
June 26, 2020
Expires
Max points
100
Description

CASP14 has released this refinement target with this additional explanation: "Hard refinement target. Starting model's GDT_HA=28." This means that less than one third of this starting model matches the unreleased native structure. Try exploring as far as you can from the starting structure!



Sequence:


MRIDELVPADPRAVSLYTPYYSQANRRRYLPYALSLYQGSSIEGSRAVEGGAPISFVATWTVTPLPADMTRCHLQFNNDAELTYEILLPNHEFLEYLIDMLMGYQRMQKTDFPGAFYRRLLGYDS

Top groups


  1. Avatar for Go Science 100 pts. 11,569
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 79 pts. 11,077
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 11,041
  4. Avatar for Contenders 4. Contenders 47 pts. 11,024
  5. Avatar for Void Crushers 5. Void Crushers 35 pts. 10,972
  6. Avatar for Beta Folders 6. Beta Folders 26 pts. 10,954
  7. Avatar for Gargleblasters 7. Gargleblasters 19 pts. 10,914
  8. Avatar for Hold My Beer 8. Hold My Beer 14 pts. 10,792
  9. Avatar for Hun-Magyar Csapat 9. Hun-Magyar Csapat 10 pts. 10,659
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 7 pts. 10,610

  1. Avatar for Xartos
    1. Xartos Lv 1
    100 pts. 11,177
  2. Avatar for Phyx 2. Phyx Lv 1 98 pts. 11,172
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 96 pts. 11,121
  4. Avatar for christioanchauvin 4. christioanchauvin Lv 1 93 pts. 11,077
  5. Avatar for johnmitch 5. johnmitch Lv 1 91 pts. 11,056
  6. Avatar for g_b 6. g_b Lv 1 89 pts. 11,028
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 87 pts. 11,024
  8. Avatar for drjr 8. drjr Lv 1 84 pts. 11,006
  9. Avatar for Aubade01 9. Aubade01 Lv 1 82 pts. 11,005
  10. Avatar for KarenCH 10. KarenCH Lv 1 80 pts. 11,002

Comments