Placeholder image of a protein
Icon representing a puzzle

1795: Revisiting Puzzle 91: Virus Protein

Closed since over 2 years ago

Novice Overall Prediction

Summary


Created
February 05, 2020
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.



Sequence:


ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH

Top groups


  1. Avatar for Go Science 100 pts. 10,501
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,489
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,394
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,363
  5. Avatar for Gargleblasters 5. Gargleblasters 31 pts. 10,245
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 22 pts. 10,244
  7. Avatar for Contenders 7. Contenders 15 pts. 10,157
  8. Avatar for Hun-Magyar Csapat 8. Hun-Magyar Csapat 11 pts. 10,098
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,079
  10. Avatar for FoldIt@Netherlands 10. FoldIt@Netherlands 5 pts. 10,078

  1. Avatar for Aubade01
    1. Aubade01 Lv 1
    100 pts. 10,539
  2. Avatar for Phyx 2. Phyx Lv 1 97 pts. 10,497
  3. Avatar for tyler0911 3. tyler0911 Lv 1 94 pts. 10,476
  4. Avatar for dcrwheeler 4. dcrwheeler Lv 1 92 pts. 10,470
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 89 pts. 10,436
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 86 pts. 10,428
  7. Avatar for Threeoak 7. Threeoak Lv 1 83 pts. 10,401
  8. Avatar for grogar7 8. grogar7 Lv 1 81 pts. 10,398
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 78 pts. 10,391
  10. Avatar for NinjaGreg 10. NinjaGreg Lv 1 76 pts. 10,391

Comments