Placeholder image of a protein
Icon representing a puzzle

1731: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 3 years ago

Novice Overall Prediction

Summary


Created
September 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Go Science 100 pts. 10,893
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 10,851
  3. Avatar for Beta Folders 3. Beta Folders 58 pts. 10,843
  4. Avatar for Marvin's bunch 4. Marvin's bunch 43 pts. 10,789
  5. Avatar for Void Crushers 5. Void Crushers 31 pts. 10,755
  6. Avatar for Contenders 6. Contenders 22 pts. 10,736
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,694
  8. Avatar for Russian team 8. Russian team 11 pts. 10,692
  9. Avatar for The Daydreamers 9. The Daydreamers 7 pts. 10,515
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 10,465

  1. Avatar for dcrwheeler
    1. dcrwheeler Lv 1
    100 pts. 10,897
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 96 pts. 10,893
  3. Avatar for RockOn 3. RockOn Lv 1 92 pts. 10,839
  4. Avatar for Deleted player 4. Deleted player pts. 10,831
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 85 pts. 10,829
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 81 pts. 10,809
  7. Avatar for johnmitch 7. johnmitch Lv 1 77 pts. 10,786
  8. Avatar for frood66 8. frood66 Lv 1 74 pts. 10,772
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 71 pts. 10,755
  10. Avatar for Angus 10. Angus Lv 1 68 pts. 10,749

Comments