Placeholder image of a protein
Icon representing a puzzle

1677: Revisiting Puzzle 137: Rosetta Decoy

Closed since over 3 years ago

Novice Overall Prediction

Summary


Created
May 22, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE

Top groups


  1. Avatar for Beta Folders 100 pts. 11,905
  2. Avatar for Contenders 2. Contenders 73 pts. 11,686
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 11,671
  4. Avatar for Go Science 4. Go Science 36 pts. 11,577
  5. Avatar for Gargleblasters 5. Gargleblasters 24 pts. 11,563
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 11,508
  7. Avatar for Marvin's bunch 7. Marvin's bunch 10 pts. 11,471
  8. Avatar for Hold My Beer 8. Hold My Beer 6 pts. 11,430
  9. Avatar for Void Crushers 9. Void Crushers 4 pts. 11,420
  10. Avatar for Russian team 10. Russian team 2 pts. 11,355

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 11,905
  2. Avatar for crpainter 2. crpainter Lv 1 97 pts. 11,686
  3. Avatar for johnmitch 3. johnmitch Lv 1 93 pts. 11,652
  4. Avatar for tyler0911 4. tyler0911 Lv 1 90 pts. 11,614
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 87 pts. 11,577
  6. Avatar for grogar7 6. grogar7 Lv 1 83 pts. 11,574
  7. Avatar for Galaxie 7. Galaxie Lv 1 80 pts. 11,563
  8. Avatar for Phyx 8. Phyx Lv 1 77 pts. 11,541
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 74 pts. 11,536
  10. Avatar for actiasluna 10. actiasluna Lv 1 72 pts. 11,529

Comments