Placeholder image of a protein
Icon representing a puzzle

1667: "Too Much Density!" Freestyle puzzle

Closed since over 3 years ago

Overall Prediction Electron Density

Summary


Created
April 25, 2019
Expires
Max points
100
Description

This Electron Density puzzle is different than anything we've ever posted before! The extended chain is 187 residues long, but we are giving you a lot more density than that. You'll need to find where to fit this chain in the giant blob of density. (The "Trim Density" tool will be your friend)

Top groups


  1. Avatar for Go Science 100 pts. 22,258
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 20,387
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 20,350
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 20,245
  5. Avatar for Russian team 5. Russian team 24 pts. 20,076
  6. Avatar for Hold My Beer 6. Hold My Beer 16 pts. 20,019
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 19,955
  8. Avatar for Marvin's bunch 8. Marvin's bunch 6 pts. 19,897
  9. Avatar for Hun-Magyar Csapat 9. Hun-Magyar Csapat 4 pts. 19,876
  10. Avatar for L'Alliance Francophone 10. L'Alliance Francophone 2 pts. 19,761

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 22,033
  2. Avatar for Bautho 2. Bautho Lv 1 97 pts. 21,534
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 94 pts. 21,104
  4. Avatar for Galaxie 4. Galaxie Lv 1 91 pts. 20,343
  5. Avatar for johnmitch 5. johnmitch Lv 1 88 pts. 20,331
  6. Avatar for LociOiling 6. LociOiling Lv 1 85 pts. 20,264
  7. Avatar for pvc78 7. pvc78 Lv 1 82 pts. 20,240
  8. Avatar for Deleted player 8. Deleted player pts. 20,239
  9. Avatar for Susume 9. Susume Lv 1 77 pts. 20,203
  10. Avatar for vakobo 10. vakobo Lv 1 74 pts. 20,076

Comments


jeff101 Lv 1

It looks like this puzzle starts with an extended chain with all residues having loop as their secondary structure.
If there is a reliable secondary structure prediction for this puzzle, please post it here.

Thanks!

Bruno Kestemont Lv 1

lrpalstfiflllitggvypllttvlgqwwfpwqangsliregdtvrgsaligqnftgngyfhgrpsat
aempynpqasggsnlavsnpeldkliaarvaalraanpdasasvpvelvtasasgldnnitpq
aaawqiprvakarnlsveqltqliakysqqplvkyigqpvvnivelnlaldklde

Bruno Kestemont Lv 1

LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLEEEEELLEEEEEEELLLLLLLL
LLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHHLLLLLLLLLHHHHHLL
LLLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLLLLLLLLLLHHHHHH

but there are not so many helices in the cloud …

Anfinsen_slept_here Lv 1

What do you mean by "a lot more density"? I would love to know more. Does what we are given correspond to more than 1 asymmetric unit?
What do we expect to find there? 2 monomers, 3 monomers, another different peptide? Where does this density come from? X-ray diffraction, cryo-EM?
Resolution? I think some stuff like that would help us know what we are looking at. Thanks

jeff101 Lv 1

Is it possible that a section of the protein, say segments 1-30,
appears in the displayed ED cloud more than once? Could the
ED cloud be showing more than one conformation of the protein
simultaneously? Could the ED cloud be showing the average
of a distribution of conformations so that some regions of the
cloud look fatter than others? Is some part of the ED cloud
from proteins, ligands, or solvent molecules distinct from the
187-segment amino acid sequence you've given us? Should
we expect one continuous copy of our 187-segment chain to
be in the ED cloud, or should we expect one or more partial
copies of the chain to appear? Several partial copies would
seem to have multiple NH2 and COO termini, which would
be confusing.

Is this ED puzzle different from previous ones because usually
you trim the extra density before posting the puzzle, but here you
give us a very raw un-trimmed ED cloud? Is there some other key
difference between this ED puzzle and previous ones? Should we
expect unusually large Density subscores when we Tab on residues
in this puzzle?

Is the ED cloud here from a crystal or from a sample in solution?
At what temperature was the ED data taken?

When we use the Trim Density tool, do we just alter the appearance
of the ED cloud, or do we directly affect the scoring as well?

The pages below might be helpful:
https://foldit.fandom.com/wiki/Electron_Density_Puzzles
https://foldit.fandom.com/wiki/Electron_density_(tool)
https://fold.it/portal/node/995580 (Electron Density Trim)

Thanks!

toshiue Lv 1

RaptorX LLHHHHHHHHHHHHHHLHHHHHHHHHHHHHLLLLLLLLEEEELLEEEE
LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHH
LLLLLLLLLLLHHLLLLLLLLLLLLHHHHHLLHHHHHHHHLLLHHHHHHHHHHHLLLLLLLLLLLLLLLHHHHHHHHLLLLL 187
bruno psipred LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLLEEEEELLEEEEEEE
LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHH
LLLLLLLLLHHHHHLLLLLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLLLLLLLLLLHHHHHH 180
PsiPred LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLEEEEELLEEEEEEEE
LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHH
LLLLLLLLLHHHHHLLLLLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLLLLLLLLHHHHHHHHHHHHLLL 187
Jpred4 LHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHLLLLLLEEEEELLEEEEEEEE
LLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLHHHHHHHHHHHHHHHHH
LLLLLLLLLHHHHHLLLLLLLLLLLHHHHHHHHHHHHHHLLLLHHHHHHHHHHHLLLLLLLLLLLLLHHHHHHHHHHHHLLL 187

toshiue Lv 1

one other secondary currently in play…

phyx17870 LLLLEELLLLLLLLLLLHHHHHHHHHHLLLLLLLLLLLLEELLLLLLLLL
HHHHHHHHHHHHHLLLLLLLLLLLLLLHHHHHHLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLL
LLLLLLLLLLLLLLLLHHHHELLLLHHHHHHHLLLLLLLLLLLHHHLLHHHHHLLLLELLLLLLLLLLLLLLL 187

Bautho Lv 1

The structure is actually known: look at PDB entry 5MRW
But it does not seem easy to build…

Bruno Kestemont Lv 1

For my computer, density cloud is toooo slooow (video card limitation I suppose). Almost impossible to play (hand fold). More time would be needed.