Placeholder image of a protein
Icon representing a puzzle

1599: Revisiting Puzzle 86: Nematode

Closed since about 4 years ago

Novice Overall Prediction

Summary


Created
November 13, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, isolated from the hookworm A. caninum, is an extremely potent anticoagulant. This protein contains ten cysteine residues that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

KATMQCGENEKYDSCGSKECDKKCKYDGVEEEDDEEPNVPCLVRVCHQDCVCEEGFYRNKDDKCVSAEDCELDNMDFIYPGTRNP

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 11,311
  2. Avatar for Contenders 2. Contenders 78 pts. 11,044
  3. Avatar for Beta Folders 3. Beta Folders 60 pts. 11,022
  4. Avatar for Gargleblasters 4. Gargleblasters 45 pts. 10,992
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 33 pts. 10,854
  6. Avatar for Go Science 6. Go Science 24 pts. 10,812
  7. Avatar for Marvin's bunch 7. Marvin's bunch 17 pts. 10,708
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 10,668
  9. Avatar for Russian team 9. Russian team 8 pts. 10,153
  10. Avatar for Hun-Magyar Csapat 10. Hun-Magyar Csapat 6 pts. 9,520

  1. Avatar for tyler0911
    1. tyler0911 Lv 1
    100 pts. 11,284
  2. Avatar for Mark- 2. Mark- Lv 1 97 pts. 11,044
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 11,009
  4. Avatar for Skippysk8s 4. Skippysk8s Lv 1 91 pts. 10,977
  5. Avatar for LociOiling 5. LociOiling Lv 1 88 pts. 10,909
  6. Avatar for Galaxie 6. Galaxie Lv 1 85 pts. 10,863
  7. Avatar for dcrwheeler 7. dcrwheeler Lv 1 82 pts. 10,859
  8. Avatar for nicobul 8. nicobul Lv 1 79 pts. 10,854
  9. Avatar for NinjaGreg 9. NinjaGreg Lv 1 77 pts. 10,812
  10. Avatar for actiasluna 10. actiasluna Lv 1 74 pts. 10,802

Comments