Placeholder image of a protein
Icon representing a puzzle

1520: Revisiting Puzzle 64: Thioredoxin

Closed since over 4 years ago

Intermediate Overall Prediction

Summary


Created
May 14, 2018
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This human protein helps to regulate the reduction potential of the cell, and should be modeled here in reduced form (with no disulfide bonds). We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVNDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Top groups


  1. Avatar for Void Crushers 100 pts. 11,805
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 11,787
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 56 pts. 11,747
  4. Avatar for Go Science 4. Go Science 41 pts. 11,746
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 11,682
  6. Avatar for Marvin's bunch 6. Marvin's bunch 20 pts. 11,658
  7. Avatar for Contenders 7. Contenders 14 pts. 11,626
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 9 pts. 11,603
  9. Avatar for Hun-Magyar Csapat 9. Hun-Magyar Csapat 6 pts. 11,594
  10. Avatar for Russian team 10. Russian team 4 pts. 11,511

  1. Avatar for Timo van der Laan 100 pts. 11,783
  2. Avatar for smilingone 2. smilingone Lv 1 97 pts. 11,778
  3. Avatar for ZeroLeak7 3. ZeroLeak7 Lv 1 94 pts. 11,746
  4. Avatar for pauldunn 4. pauldunn Lv 1 91 pts. 11,744
  5. Avatar for LociOiling 5. LociOiling Lv 1 88 pts. 11,732
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 85 pts. 11,725
  7. Avatar for Deleted player 7. Deleted player pts. 11,723
  8. Avatar for bertro 8. bertro Lv 1 80 pts. 11,709
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 77 pts. 11,706
  10. Avatar for Galaxie 10. Galaxie Lv 1 74 pts. 11,694

Comments