Placeholder image of a protein
Icon representing a puzzle

1444: Unsolved De-novo Freestyle 119

Closed since almost 5 years ago

Intermediate Overall Prediction

Summary


Created
October 30, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TRELYVEIRGGDKEEIKKLIEEIKRESERLEKEQGGEIRVEVRDHNGNVLIRVEIRGGRDEEIKKMWEKLEKRIKETVKKLGGEVNIQEK

Top groups


  1. Avatar for Go Science 100 pts. 10,148
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 10,013
  3. Avatar for Marvin's bunch 3. Marvin's bunch 60 pts. 10,011
  4. Avatar for Beta Folders 4. Beta Folders 45 pts. 9,982
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 9,879
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 24 pts. 9,841
  7. Avatar for Deleted group 7. Deleted group pts. 9,668
  8. Avatar for Void Crushers 8. Void Crushers 12 pts. 9,652
  9. Avatar for Contenders 9. Contenders 8 pts. 9,644
  10. Avatar for Deleted group 10. Deleted group pts. 9,416

  1. Avatar for ZeroLeak7
    1. ZeroLeak7 Lv 1
    100 pts. 10,148
  2. Avatar for fiendish_ghoul 2. fiendish_ghoul Lv 1 98 pts. 10,090
  3. Avatar for caglar 3. caglar Lv 1 95 pts. 10,089
  4. Avatar for isaksson 4. isaksson Lv 1 92 pts. 10,014
  5. Avatar for Galaxie 5. Galaxie Lv 1 89 pts. 10,013
  6. Avatar for Susume 6. Susume Lv 1 86 pts. 10,002
  7. Avatar for retiredmichael 7. retiredmichael Lv 1 84 pts. 9,967
  8. Avatar for frood66 8. frood66 Lv 1 81 pts. 9,923
  9. Avatar for tamanrasset 9. tamanrasset Lv 1 79 pts. 9,903
  10. Avatar for Enzyme 10. Enzyme Lv 1 76 pts. 9,877

Comments


Susume Lv 1

I really want to mutate that serine in the helix to something else, as in my current model it is a buried polar!