Placeholder image of a protein
Icon representing a puzzle

1429: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 5 years ago

Intermediate Overall Prediction

Summary


Created
September 12, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Beta Folders 100 pts. 9,992
  2. Avatar for Gargleblasters 2. Gargleblasters 73 pts. 9,971
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,941
  4. Avatar for Void Crushers 4. Void Crushers 36 pts. 9,938
  5. Avatar for Go Science 5. Go Science 24 pts. 9,926
  6. Avatar for Contenders 6. Contenders 16 pts. 9,923
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 10 pts. 9,923
  8. Avatar for Hun-Magyar Csapat 8. Hun-Magyar Csapat 6 pts. 9,893
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 9,880
  10. Avatar for Natural Abilities 10. Natural Abilities 2 pts. 9,714

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 9,992
  2. Avatar for Enzyme 2. Enzyme Lv 1 98 pts. 9,971
  3. Avatar for actiasluna 3. actiasluna Lv 1 95 pts. 9,947
  4. Avatar for Galaxie 4. Galaxie Lv 1 92 pts. 9,941
  5. Avatar for Timo van der Laan 5. Timo van der Laan Lv 1 89 pts. 9,938
  6. Avatar for retiredmichael 6. retiredmichael Lv 1 86 pts. 9,929
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 84 pts. 9,926
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 81 pts. 9,923
  9. Avatar for nicobul 9. nicobul Lv 1 78 pts. 9,923
  10. Avatar for smilingone 10. smilingone Lv 1 76 pts. 9,912

Comments