Placeholder image of a protein
Icon representing a puzzle

1415: Revisiting Puzzle 136: Cell Adhesion

Closed since about 5 years ago

Intermediate Overall Prediction

Summary


Created
August 10, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT

Top groups


  1. Avatar for Contenders 100 pts. 9,570
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 9,561
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 9,489
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 9,476
  5. Avatar for Beta Folders 5. Beta Folders 16 pts. 9,459
  6. Avatar for Go Science 6. Go Science 9 pts. 9,449
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 5 pts. 9,399
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,390
  9. Avatar for Hun-Magyar Csapat 9. Hun-Magyar Csapat 1 pt. 9,149
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 1 pt. 9,057

  1. Avatar for Glen B
    1. Glen B Lv 1
    100 pts. 9,824
  2. Avatar for gitwut 2. gitwut Lv 1 97 pts. 9,570
  3. Avatar for Enzyme 3. Enzyme Lv 1 93 pts. 9,552
  4. Avatar for eusair 4. eusair Lv 1 90 pts. 9,493
  5. Avatar for markm457 5. markm457 Lv 1 86 pts. 9,489
  6. Avatar for Skippysk8s 6. Skippysk8s Lv 1 83 pts. 9,488
  7. Avatar for Blipperman 7. Blipperman Lv 1 80 pts. 9,480
  8. Avatar for actiasluna 8. actiasluna Lv 1 77 pts. 9,477
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 74 pts. 9,476
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 71 pts. 9,476

Comments