Placeholder image of a protein
Icon representing a puzzle

1409: Revisiting Puzzle 135: E. coli

Closed since about 5 years ago

Intermediate Overall Prediction

Summary


Created
July 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 8,926
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 8,922
  3. Avatar for Go Science 3. Go Science 58 pts. 8,906
  4. Avatar for Contenders 4. Contenders 43 pts. 8,889
  5. Avatar for Marvin's bunch 5. Marvin's bunch 31 pts. 8,855
  6. Avatar for Gargleblasters 6. Gargleblasters 22 pts. 8,833
  7. Avatar for Void Crushers 7. Void Crushers 15 pts. 8,828
  8. Avatar for Hun-Magyar Csapat 8. Hun-Magyar Csapat 11 pts. 8,825
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 7 pts. 8,789
  10. Avatar for GC Sommerlejr 2017 10. GC Sommerlejr 2017 5 pts. 8,643

  1. Avatar for markm457
    1. markm457 Lv 1
    100 pts. 8,925
  2. Avatar for LociOiling 2. LociOiling Lv 1 97 pts. 8,922
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 94 pts. 8,919
  4. Avatar for eusair 4. eusair Lv 1 91 pts. 8,915
  5. Avatar for gmn 5. gmn Lv 1 88 pts. 8,912
  6. Avatar for ZeroLeak7 6. ZeroLeak7 Lv 1 85 pts. 8,906
  7. Avatar for fiendish_ghoul 7. fiendish_ghoul Lv 1 82 pts. 8,895
  8. Avatar for gitwut 8. gitwut Lv 1 79 pts. 8,889
  9. Avatar for mimi 9. mimi Lv 1 77 pts. 8,884
  10. Avatar for crpainter 10. crpainter Lv 1 74 pts. 8,877

Comments