Placeholder image of a protein
Icon representing a puzzle

1330: Revisiting Puzzle 85: Cell Adhesion Protein

Closed since over 5 years ago

Intermediate Overall Prediction

Summary


Created
January 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small domain is part of a larger protein that mediates interactions between other proteins in human development. This protein contains several cysteine residues, but we'd like to model them in a reducing environment, so they should NOT form disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

MANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAPC

Top groups


  1. Avatar for Beta Folders 100 pts. 8,955
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 78 pts. 8,947
  3. Avatar for Contenders 3. Contenders 60 pts. 8,934
  4. Avatar for Go Science 4. Go Science 45 pts. 8,904
  5. Avatar for Gargleblasters 5. Gargleblasters 33 pts. 8,879
  6. Avatar for Void Crushers 6. Void Crushers 24 pts. 8,878
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 17 pts. 8,831
  8. Avatar for Hun-Magyar Csapat 8. Hun-Magyar Csapat 12 pts. 8,760
  9. Avatar for Kotocycle 9. Kotocycle 8 pts. 8,617
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 6 pts. 8,613

  1. Avatar for retiredmichael
    1. retiredmichael Lv 1
    100 pts. 8,949
  2. Avatar for Galaxie 2. Galaxie Lv 1 98 pts. 8,944
  3. Avatar for LociOiling 3. LociOiling Lv 1 95 pts. 8,943
  4. Avatar for gitwut 4. gitwut Lv 1 92 pts. 8,928
  5. Avatar for pauldunn 5. pauldunn Lv 1 89 pts. 8,901
  6. Avatar for reefyrob 6. reefyrob Lv 1 86 pts. 8,899
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 84 pts. 8,898
  8. Avatar for hpaege 8. hpaege Lv 1 81 pts. 8,889
  9. Avatar for Blipperman 9. Blipperman Lv 1 79 pts. 8,879
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 76 pts. 8,878

Comments