Placeholder image of a protein
Icon representing a puzzle

1324: Revisiting Puzzle 83: Cardiotoxin

Closed since over 5 years ago

Intermediate Overall Prediction

Summary


Created
January 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN

Top groups


  1. Avatar for Contenders 100 pts. 9,624
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,624
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 52 pts. 9,599
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 36 pts. 9,582
  5. Avatar for Go Science 5. Go Science 24 pts. 9,579
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,569
  7. Avatar for Gargleblasters 7. Gargleblasters 10 pts. 9,543
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 6 pts. 9,230
  9. Avatar for Deleted group 9. Deleted group pts. 9,020
  10. Avatar for xkcd 10. xkcd 2 pts. 8,891

  1. Avatar for fiendish_ghoul
    1. fiendish_ghoul Lv 1
    100 pts. 9,635
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 98 pts. 9,624
  3. Avatar for LociOiling 3. LociOiling Lv 1 95 pts. 9,624
  4. Avatar for gitwut 4. gitwut Lv 1 92 pts. 9,611
  5. Avatar for reefyrob 5. reefyrob Lv 1 90 pts. 9,609
  6. Avatar for markm457 6. markm457 Lv 1 87 pts. 9,597
  7. Avatar for Museka 7. Museka Lv 1 84 pts. 9,582
  8. Avatar for Bruno Kestemont 8. Bruno Kestemont Lv 1 82 pts. 9,579
  9. Avatar for johnmitch 9. johnmitch Lv 1 80 pts. 9,573
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 77 pts. 9,569

Comments


bertro Lv 1

The chains are a bit different:

1320: LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
1324: LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN