Placeholder image of a protein
Icon representing a puzzle

1298: Revisiting Puzzle 75: Antifreeze Protein

Closed since almost 6 years ago

Intermediate Overall Prediction

Summary


Created
October 18, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,009
  2. Avatar for Contenders 2. Contenders 80 pts. 9,000
  3. Avatar for Go Science 3. Go Science 63 pts. 8,991
  4. Avatar for Beta Folders 4. Beta Folders 49 pts. 8,990
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 8,990
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 8,981
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 8,971
  8. Avatar for Hun-Magyar Csapat 8. Hun-Magyar Csapat 15 pts. 8,969
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 11 pts. 8,836
  10. Avatar for xkcd 10. xkcd 8 pts. 8,833

  1. Avatar for markm457
    1. markm457 Lv 1
    100 pts. 9,002
  2. Avatar for Aubade01 2. Aubade01 Lv 1 98 pts. 9,002
  3. Avatar for johnmitch 3. johnmitch Lv 1 96 pts. 8,998
  4. Avatar for Jim Fraser 4. Jim Fraser Lv 1 94 pts. 8,994
  5. Avatar for georg137 5. georg137 Lv 1 92 pts. 8,994
  6. Avatar for randomlil 6. randomlil Lv 1 89 pts. 8,990
  7. Avatar for nicobul 7. nicobul Lv 1 87 pts. 8,990
  8. Avatar for LociOiling 8. LociOiling Lv 1 85 pts. 8,987
  9. Avatar for retiredmichael 9. retiredmichael Lv 1 83 pts. 8,985
  10. Avatar for diamond_dust 10. diamond_dust Lv 1 81 pts. 8,985

Comments


Aubade01 Lv 1

Since the score is so close I am posting mine early as a player courtesy.

I am not a gamer, but a contributor who prefers to work offline. However, I realize other players are gamers and may not like a potential high score kept offline until game close.

Aubade01 (Aubade00)