Placeholder image of a protein
Icon representing a puzzle

1296: Electron Density Reconstruction 1: Original Density

Closed since almost 6 years ago

Intermediate Overall Prediction Electron Density

Summary


Created
October 17, 2016
Expires
Max points
100
Description

This is a followup to Puzzle 1249 and Puzzle 1274, this time with a density map drawn directly from the published structure. Players may load in solutions from Puzzle 1249 and Puzzle 1274.



The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model.



Sequence:


SRYTHFLTQHYDAKPQGRDDRYCESIMRRRGLTSPCKDINTFIHGNKRSIKAICENKNGNPHRENLRISKSSFQVTTCKLHGGSPWPPCQYRATAGFRNVVVACENGLLVHLDQSIFRR

Top groups


  1. Avatar for Beta Folders 100 pts. 12,819
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 77 pts. 12,793
  3. Avatar for Void Crushers 3. Void Crushers 58 pts. 12,787
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 43 pts. 12,773
  5. Avatar for Contenders 5. Contenders 31 pts. 12,746
  6. Avatar for Go Science 6. Go Science 22 pts. 12,724
  7. Avatar for Gargleblasters 7. Gargleblasters 15 pts. 12,690
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 11 pts. 12,219
  9. Avatar for It's over 9000! 9. It's over 9000! 7 pts. 11,934
  10. Avatar for Deleted group 10. Deleted group pts. 9,298

  1. Avatar for Madde
    1. Madde Lv 1
    100 pts. 12,787
  2. Avatar for christioanchauvin 2. christioanchauvin Lv 1 98 pts. 12,773
  3. Avatar for bertro 3. bertro Lv 1 95 pts. 12,771
  4. Avatar for Susume 4. Susume Lv 1 93 pts. 12,768
  5. Avatar for LociOiling 5. LociOiling Lv 1 91 pts. 12,765
  6. Avatar for pmdpmd 6. pmdpmd Lv 1 88 pts. 12,756
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 86 pts. 12,738
  8. Avatar for nicobul 8. nicobul Lv 1 84 pts. 12,734
  9. Avatar for Timo van der Laan 9. Timo van der Laan Lv 1 82 pts. 12,731
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 79 pts. 12,720

Comments


Bruno Kestemont Lv 1

When loading an old shared solution, we need the oldest solution points + 2 to evolve instead of the current score + 2. This makes about 100 points to evolve.

gitwut Lv 1

How is this different from 1249? I've reread 1249 and 1274. Isn't this the same map data used in 1249? Maybe I've forgotten, have the ED tools been re-worked since then?

Bruno Kestemont Lv 1

Top score 1249 was about 13600 (but about 1000 pts less when we load it)
Top score 1274 was about 12000

If I load the best old score, I would be encouraged to work on 1249 solutions (with same cloud). What is then the expected use of 1274?

Are the score functions the same? (it seems not)

The good news is that 1274 was very slow and this problem seems solved now.

Bruno Kestemont Lv 1

Great idea to let us work on a 1274's player's design first developed in 1249 by only a few talentuous players. This helped everybody to get a "soloist" design into the cloud, which we can now further develop without a long difficult hand fold and with a published (aparently trimmed ?) cloud.

bkoep Staff Lv 1

In Puzzle 1249, we took some steps to reduce model bias in the density map (see this comment).

This density map should appear much cleaner and less noisy than Puzzle 1249, though it is more prone to model bias (parts of the map may be artificially reinforced to agree with the published structure).

Skippysk8s Lv 1

I finally loaded the new client…. but this puzzle still doesn't work for me. I load an evo share and need over 1000 points to get to evo? This puzzle is broken. please zero me out. I'd really like to learn to work these. This is not the way
Suggestions in abundance on the forum thread from many players. Give us training tools please

actiasluna Lv 1

This one is a) too big for my new-to-ED eyes to see the structures, and b) can't get a good evo score due to how the evo score is being calculated, which currently is my only hope for such a large puzzle as not sufficient hours in the day between work and sleep to work this one as it needs to be worked from scratch.

Almost didn't post this as I don't want to be seen as "whining" … I know all are in the same "scoring" boat on this, with only the best old puzzle scorers and experienced ED players having a slight edge. That written, the more we get to practice on smaller easier to see puzzles, the better our less-experienced folders will get, and quicker… which ultimately is good for the science. Thus this comment. - Thanks