Placeholder image of a protein
Icon representing a puzzle

1284: Revisiting Puzzle 71: Crystallin

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
September 14, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,589
  2. Avatar for Go Science 2. Go Science 76 pts. 9,584
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 9,577
  4. Avatar for Contenders 4. Contenders 41 pts. 9,573
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 9,553
  6. Avatar for Void Crushers 6. Void Crushers 20 pts. 9,539
  7. Avatar for Anthropic Dreams 7. Anthropic Dreams 14 pts. 9,525
  8. Avatar for Italiani Al Lavoro 8. Italiani Al Lavoro 9 pts. 9,503
  9. Avatar for Hun-Magyar Csapat 9. Hun-Magyar Csapat 6 pts. 9,465
  10. Avatar for Natural Abilities 10. Natural Abilities 4 pts. 9,334

  1. Avatar for reefyrob
    1. reefyrob Lv 1
    100 pts. 9,589
  2. Avatar for Aubade01 2. Aubade01 Lv 1 98 pts. 9,587
  3. Avatar for Scopper 3. Scopper Lv 1 96 pts. 9,583
  4. Avatar for pmdpmd 4. pmdpmd Lv 1 94 pts. 9,577
  5. Avatar for dembones 5. dembones Lv 1 93 pts. 9,573
  6. Avatar for LociOiling 6. LociOiling Lv 1 91 pts. 9,564
  7. Avatar for g_b 7. g_b Lv 1 89 pts. 9,560
  8. Avatar for JayD7217 8. JayD7217 Lv 1 87 pts. 9,551
  9. Avatar for pauldunn 9. pauldunn Lv 1 85 pts. 9,550
  10. Avatar for Bruno Kestemont 10. Bruno Kestemont Lv 1 83 pts. 9,548

Comments