Placeholder image of a protein
Icon representing a puzzle

1281: Revisiting Puzzle 70: Nucleosome Protein

Closed since about 6 years ago

Intermediate Overall Prediction

Summary


Created
September 06, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,562
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,524
  3. Avatar for Go Science 3. Go Science 54 pts. 9,504
  4. Avatar for Contenders 4. Contenders 38 pts. 9,499
  5. Avatar for Void Crushers 5. Void Crushers 27 pts. 9,424
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 18 pts. 9,404
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,404
  8. Avatar for Hun-Magyar Csapat 8. Hun-Magyar Csapat 8 pts. 9,392
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 9,334
  10. Avatar for It's over 9000! 10. It's over 9000! 3 pts. 9,245

  1. Avatar for Vredeman
    1. Vredeman Lv 1
    100 pts. 9,548
  2. Avatar for Galaxie 2. Galaxie Lv 1 98 pts. 9,522
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 96 pts. 9,520
  4. Avatar for KarenCH 4. KarenCH Lv 1 93 pts. 9,509
  5. Avatar for Bruno Kestemont 5. Bruno Kestemont Lv 1 91 pts. 9,502
  6. Avatar for reefyrob 6. reefyrob Lv 1 89 pts. 9,499
  7. Avatar for dembones 7. dembones Lv 1 86 pts. 9,499
  8. Avatar for gitwut 8. gitwut Lv 1 84 pts. 9,496
  9. Avatar for bertro 9. bertro Lv 1 82 pts. 9,487
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 80 pts. 9,475

Comments