Placeholder image of a protein
Icon representing a puzzle

1180: Unsolved De-novo Freestyle 64

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
January 09, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


ELKEEVERLRREGQSKVDTGKVYFFGDRWMVYRGKEVTYQGKEISGNEEEVEKLWKKVEEEFKKK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,274
  2. Avatar for Beta Folders 2. Beta Folders 73 pts. 9,178
  3. Avatar for Void Crushers 3. Void Crushers 52 pts. 9,167
  4. Avatar for Gargleblasters 4. Gargleblasters 36 pts. 9,148
  5. Avatar for Contenders 5. Contenders 24 pts. 9,064
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 16 pts. 9,021
  7. Avatar for Go Science 7. Go Science 10 pts. 9,005
  8. Avatar for Hun-Magyar Csapat 8. Hun-Magyar Csapat 6 pts. 8,966
  9. Avatar for Deleted group 9. Deleted group pts. 8,915
  10. Avatar for BOINC@Poland 10. BOINC@Poland 2 pts. 8,830

  1. Avatar for viosca
    1. viosca Lv 1
    100 pts. 9,274
  2. Avatar for Susume 2. Susume Lv 1 98 pts. 9,262
  3. Avatar for jermainiac 3. jermainiac Lv 1 96 pts. 9,180
  4. Avatar for LociOiling 4. LociOiling Lv 1 94 pts. 9,178
  5. Avatar for Madde 5. Madde Lv 1 92 pts. 9,167
  6. Avatar for Galaxie 6. Galaxie Lv 1 90 pts. 9,148
  7. Avatar for grogar7 7. grogar7 Lv 1 88 pts. 9,141
  8. Avatar for frood66 8. frood66 Lv 1 86 pts. 9,133
  9. Avatar for MurloW 9. MurloW Lv 1 84 pts. 9,126
  10. Avatar for Timo van der Laan 10. Timo van der Laan Lv 1 83 pts. 9,119

Comments