Placeholder image of a protein
Icon representing a puzzle

1146: Revisiting Puzzle 94: Mouse

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary


Created
October 06, 2015
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM

Top groups


  1. Avatar for Go Science 100 pts. 9,197
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 81 pts. 9,160
  3. Avatar for Gargleblasters 3. Gargleblasters 65 pts. 9,087
  4. Avatar for Beta Folders 4. Beta Folders 52 pts. 9,078
  5. Avatar for Hun-Magyar Csapat 5. Hun-Magyar Csapat 41 pts. 9,050
  6. Avatar for Contenders 6. Contenders 32 pts. 9,003
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 24 pts. 8,999
  8. Avatar for Void Crushers 8. Void Crushers 18 pts. 8,974
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 14 pts. 8,848
  10. Avatar for xkcd 10. xkcd 10 pts. 8,807

  1. Avatar for hpaege
    1. hpaege Lv 1
    100 pts. 9,152
  2. Avatar for BitSpawn 2. BitSpawn Lv 1 98 pts. 9,143
  3. Avatar for johnmitch 3. johnmitch Lv 1 97 pts. 9,092
  4. Avatar for frood66 4. frood66 Lv 1 95 pts. 9,080
  5. Avatar for retiredmichael 5. retiredmichael Lv 1 93 pts. 9,071
  6. Avatar for pauldunn 6. pauldunn Lv 1 91 pts. 9,059
  7. Avatar for O Seki To 7. O Seki To Lv 1 89 pts. 9,050
  8. Avatar for bertro 8. bertro Lv 1 87 pts. 9,042
  9. Avatar for LociOiling 9. LociOiling Lv 1 85 pts. 9,037
  10. Avatar for mirp 10. mirp Lv 1 83 pts. 9,023

Comments