bkoep's picture
User offline. Last seen 8 hours 53 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
Waiting for secondary structure predictions

We're still waiting on the secondary structure predictions for this protein. Check back later for updates!

bkoep's picture
User offline. Last seen 8 hours 53 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
FASTA Sequence:

SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI

bkoep's picture
User offline. Last seen 8 hours 53 min ago. Offline
Joined: 11/15/2012
Groups: Foldit Staff
SAM secondary structure predictions

Here is the sequence logo predicted by the SAM server:

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!

Madde's picture
User offline. Last seen 2 years 49 weeks ago. Offline
Joined: 05/29/2008
Groups: Void Crushers
Link to the Jpred3 result of this sequence
Madde's picture
User offline. Last seen 2 years 49 weeks ago. Offline
Joined: 05/29/2008
Groups: Void Crushers
GUI recipe to set the secondary structures according to JPred

http://fold.it/portal/recipe/46925

Edit:
It's pretty much the same as the SAM prediction

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons