Fri, 09/20/2013 - 18:20
#2
FASTA Sequence:
SPILPKAENVDSICIDFTNSIQKIYDDSESIQKILSEIATGKRTEKQSIQDYPSAEEYGTINIENNGGMTTMFYYEENGKYYIECPYKGIYEIENNFEDMI
Sat, 09/21/2013 - 08:07
#3
SAM secondary structure predictions
Here is the sequence logo predicted by the SAM server:
H = helix
E = sheet
C = loop (or coil)
The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.
For example, the Isoleucines at residues 13 and 25 are highly predicted to be part of a sheet. However, the Isoleucines at residues 31 and 38 are predicted to be part of a helix!
Fri, 09/20/2013 - 18:24
#4
Link to the Jpred3 result of this sequence
Fri, 09/20/2013 - 20:25
#5
GUI recipe to set the secondary structures according to JPred
http://fold.it/portal/recipe/46925
Edit:
It's pretty much the same as the SAM prediction
We're still waiting on the secondary structure predictions for this protein. Check back later for updates!