puzzle picture
585: CASP10 Target T0722
Status: Closed

Groups

RankGroupScorePoints
1Contenders11,577100
2foldeRNA11,52880
3Anthropic Dreams11,48063
4Go Science11,42450
5Beta Folders11,37339
6Void Crushers11,34830
7Gargleblasters11,30523
8Richard Dawkins Foundation11,20517
9L'Alliance Francophone11,15513
10Androids11,12110
11Team Hungary11,0157
12Russian team10,8655
13FoldIt@Netherlands10,8624
14SETI.Germany10,7323
15Natural Abilities10,6452
16E?????! Heureka!10,4901
17Atlanta10,4361
187Monkeys10,4041
19Nerdfighters9,9001
20Another Hour Another Point9,8861
21Geekdo9,8551
22Team China8,7821
23Freedom Folders8,6831
24Mojo Risin'8,3411
25BOINC.Italy7,8541


Need this puzzle? Log in to download.  

Comments

beta_helix's picture
User offline. Last seen 12 hours 28 min ago. Offline
Joined: 05/09/2008
Groups: None
Additional info about this CASP target

Here is the CASP link for this target (showing the amino acid sequence):
http://predictioncenter.org/casp10/target.cgi?id=137
____________________________________________________

Here is the sequence logo predicted by the SAM server.

H = helix
E = sheet
C = loop (or coil)

The taller the letter at each position, the higher the probability of that specific secondary structure for that amino acid.

For example, the Leucines at residues 27, 31, 34, 60-61, 73, 82-84, 91-95, 101, 105, 116, 123, 130 & 140 are highly predicted to be in a helix. However, the Leucines at residues 14, 22-23, 150 & 152 are predicted to be anything.
____________________________________________________

Link to template PDBs:

http://www.pdb.org/pdb/explore/explore.do?structureId=1gqe
http://www.pdb.org/pdb/explore/explore.do?structureId=1ls4
http://www.pdb.org/pdb/explore/explore.do?structureId=3tul
http://www.pdb.org/pdb/explore/explore.do?structureId=3k29
http://www.pdb.org/pdb/explore/explore.do?structureId=1ya9
http://www.pdb.org/pdb/explore/explore.do?structureId=3lg7

infjamc's picture
User offline. Last seen 8 hours 49 min ago. Offline
Joined: 02/20/2009
Groups: Contenders
Just out of curiosity...

What's going on with the sequence at the N-terminus? (Is it an added polyhistidine tag, or was it a part of the "natural" sequence?)

beta_helix's picture
User offline. Last seen 12 hours 28 min ago. Offline
Joined: 05/09/2008
Groups: None
Exactly, it's most likely a his tag

In fact, the RosettaServer only modeled this sequence:
SSGRENLYFQGAGPLLTEELIKALQDLENAASGDATVRQKIASLPQEVQDVSLL
EKITDKEAAERLSKTVDEACLLLAEYNGRLAAELEDRRQLARMLVEYTQNQKDV
LSEKEKKLEEYKQKLARVTQVRKELKSHIQSLPDLSL

Although we can't be 100% sure since the CASP10 organizers did not give us any additional information about it. We'll have to see what all the servers did with the first 7 residues.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons