puzzle picture
2182: Revisiting Puzzle 144: Rosetta Decoy 8
Status: Active

Summary

Name: 2182: Revisiting Puzzle 144: Rosetta Decoy 8
Status: Active
Created: 08/03/2022
Points: 100
Expires: 08/11/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. The function of this thermophilic protein is unknown, but it is unusual among intracellular proteins in that the native structure includes disulfide bonds. This protein contains six cysteine residues that are oxidized to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKKHIIIKTIPKKEEIISRDLCDCIYYYDNSVICKPIGPSKVYVSTSLENLEKCLQLHYFKKLVKNIEIFDEVHNSKPNCDKCLIVEIGGVYFVRRVNGVP
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams12,113
2Go Science12,098
3L'Alliance Francophone12,005
4Contenders11,950
5Gargleblasters11,911

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons