|
2161: Revisiting Puzzle 140: Rosetta Decoy 4
Status: Closed
|
Summary
| Name: | 2161: Revisiting Puzzle 140: Rosetta Decoy 4 |
|---|---|
| Status: | Closed |
| Created: | 06/16/2022 |
| Points: | 100 |
| Expired: | 06/23/2022 - 18:00 |
| Difficulty: | Novice |
| Description: | This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.
Sequence:
MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
