puzzle picture
2140: Revisiting Puzzle 137: Rosetta Decoy
Status: Closed

Summary

Name: 2140: Revisiting Puzzle 137: Rosetta Decoy
Status: Closed
Created: 04/28/2022
Points: 100
Expired: 05/05/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein helps to regulate the human immune response, and the starting structure is a Rosetta model. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
YEEVSVSGFEEFHRAVEQHNGKTIFAYFTGSKDAGGKSWCPDCVQAEPVVREGLKHISEGCVFIYCQVGEKPYWKDPNNDFRKNLKVTAVPTLLKYGTPQKLVESECLQANLVEMLFSE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams11,903100
2Go Science11,76774
3L'Alliance Francophone11,71354
4Gargleblasters11,63938
5Contenders11,62927

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 9 hours 9 min ago. Offline
Joined: 12/27/2012
ducks in a row
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons