puzzle picture
2137: Electron Density Reconstruction 7
Status: Closed

Summary

Name: 2137: Electron Density Reconstruction 7
Status: Closed
Created: 04/21/2022
Points: 100
Expired: 04/28/2022 - 18:00
Difficulty: Novice
Description: The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.

Sequence:
MLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEA
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams16,734100
2Go Science16,69463
3Contenders16,57937
4Marvin's bunch16,57221
5L'Alliance Francophone16,46211

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Bruno Kestemont 3 3 Go Science16,694100
2Sandrix72 23 6  16,68195
3Galaxie 1 2 Anthropic Dreams16,67990
4LociOiling 2 1 Anthropic Dreams16,66586
5MicElephant 10 14  16,64081


Need this puzzle? Log in to download.  

Comments

No comments yet.
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons