puzzle picture
2134: Revisiting Puzzle 136: Cell Adhesion
Status: Closed

Summary

Name: 2134: Revisiting Puzzle 136: Cell Adhesion
Status: Closed
Created: 04/12/2022
Points: 100
Expired: 04/21/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,077100
2L'Alliance Francophone9,99171
3Go Science9,95049
4Gargleblasters9,89433
5Marvin's bunch9,81822

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 58 min 42 sec ago. Offline
Joined: 12/27/2012
sticky note
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons