|
2134: Revisiting Puzzle 136: Cell Adhesion
Status: Closed
|
Summary
| Name: | 2134: Revisiting Puzzle 136: Cell Adhesion |
|---|---|
| Status: | Closed |
| Created: | 04/12/2022 |
| Points: | 100 |
| Expired: | 04/21/2022 - 18:00 |
| Difficulty: | Novice |
| Description: | This is a throwback puzzle to the early days of Foldit. This small protein, from the venom of the saw-scaled viper, interferes with the cellular adhesion machinery that allows blood clotting. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ECESGPCCRNCKFLKEGTICKRARGDDMDDYCNGKTCDCPRNPHKGPAT
|
| Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
Way too late, but just for the record:
https://foldit.fandom.com/wiki/Revisiting_puzzle/136:_Cell_Adhesion