puzzle picture
2131: Revisiting Puzzle 135: E. coli
Status: Closed

Summary

Name: 2131: Revisiting Puzzle 135: E. coli
Status: Closed
Created: 04/07/2022
Points: 100
Expired: 04/14/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams9,863100
2Go Science9,71977
3Marvin's bunch9,68658
4Contenders9,67843
5L'Alliance Francophone9,63931

Top Evolvers

RankPlayerGroupScorePoints
1LociOiling 2 1 Anthropic Dreams9,852100
2Galaxie 1 2 Anthropic Dreams9,85197
3guineapig 17 13  9,83993
4MicElephant 10 14  9,83689
5gmn 4 5 Anthropic Dreams9,83585

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 2 1 Anthropic Dreams9,863100
2guineapig 17 13  9,83497
3g_b 75 28  9,73993
4NinjaGreg 26 17 Go Science9,71989
5dcrwheeler 75 4  9,71585


Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
e-E.coli
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons