puzzle picture
2125: Revisiting Puzzle 126: Ethanolamine Utilization
Status: Closed

Summary

Name: 2125: Revisiting Puzzle 126: Ethanolamine Utilization
Status: Closed
Created: 03/24/2022
Points: 100
Expired: 03/31/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein allows bacteria to metabolize ethanolamine and use it in constructing cell walls and cell membranes. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
MKLAVVTGQIVCTVRHHGLAHDKLLMVEMIDPQGNPDGQCAVAIDNIGAGTGEWVLLVSGSSARQAHKSETSPVDLCVIGIVDEVVSGGQVIFHK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,876100
2Contenders10,77776
3Go Science10,72056
4L'Alliance Francophone10,48941
5Marvin's bunch10,45429

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 2 1 Anthropic Dreams10,876100
2Bletchley Park 8 10 Contenders10,77797
3Bruno Kestemont 3 3 Go Science10,71594
4dcrwheeler 75 4  10,68290
5Sandrix72 23 6  10,62787


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 1 hour 18 min ago. Offline
Joined: 12/27/2012
fun with ethanol
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons