puzzle picture
2120: Electron Density Reconstruction 6
Status: Closed

Summary

Name: 2120: Electron Density Reconstruction 6
Status: Closed
Created: 03/11/2022
Points: 100
Expired: 03/18/2022 - 23:00
Difficulty: Intermediate
Description: The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes a glutathione ligand that is fixed in place.

Sequence:
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHSWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTFPGHSALLKGTLTLK
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders19,412100
2Go Science19,38568
3Anthropic Dreams19,37344
4Contenders19,35027
5Marvin's bunch19,30416

Top Evolvers

RankPlayerGroupScorePoints
1LociOiling 2 1 Beta Folders19,410100
2MicElephant 10 14  19,38395
3Bruno Kestemont 3 3 Go Science19,38189
4Galaxie 1 2 Anthropic Dreams19,37184
5guineapig 17 13  19,36579

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 2 1 Beta Folders19,412100
2Punzi Bake... 75 41  19,40795
3Bruno Kestemont 3 3 Go Science19,38589
4MicElephant 10 14  19,38584
5jeff101 24 78 Go Science19,37879


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 9 hours 51 min ago. Offline
Joined: 12/27/2012
has anyone seen this glutathione ligand?

We were told "puzzle includes a glutathione ligand that is fixed in place". I'm just not seeing it.

There don't seem to be any secondary structure type "M" segments. All the segments have normal amino acid codes, no type "x" segments.

I did just notice that the puzzle starts with a disulfide bridge.

I don't see anything that looks it could be a glutathione, but I guess I can keep looking.

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons