puzzle picture
2113: Revisiting Puzzle 115: Exocyst
Status: Closed

Summary

Name: 2113: Revisiting Puzzle 115: Exocyst
Status: Closed
Created: 02/24/2022
Points: 100
Expired: 03/03/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,146100
2Anthropic Dreams11,11165
3Go Science11,10641
4Contenders11,04124
5Marvin's bunch10,97814

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1LociOiling 2 1 Beta Folders11,146100
2Bruno Kestemont 3 3 Go Science11,10597
3Galaxie 1 2 Anthropic Dreams11,10094
4gmn 4 5 Anthropic Dreams11,09291
5g_b 46 31  11,08488


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 4 hours 10 min ago. Offline
Joined: 12/27/2012
the exocyst
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons