puzzle picture
2108: Electron Density Reconstruction 4
Status: Closed

Summary

Name: 2108: Electron Density Reconstruction 4
Status: Closed
Created: 02/11/2022
Points: 100
Expired: 02/18/2022 - 23:00
Difficulty: Novice
Description: The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. In addition to the protein chain, puzzle includes three sulfate ions that are fixed in place.

Sequence:
KETAAAKFERQHMDSSTSAASSSNYCNQMMKSRNLTKDRCKPVNTFVHESLADVQAVCSQKNVACKNGQTNCYQSYSTMSITDCRETGSSKYPNCAYKTTQANKHIIVACEGNPYVPVHFDASV
Categories: Electron Density, Overall, Prediction

Top Groups

RankGroupScorePoints
1Marvin's bunch20,121100
2Go Science20,05260
3Beta Folders19,99033
4Contenders19,96717
5Anthropic Dreams19,9138

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 03/30/2013
Groups: Go Science
Had to share beautiful painting by Irving Geis

https://tinyurl.com/yc5jn82t

or google PDB101 Rnase Geis

(and yes, i am indulging my personal obsession here)

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons