puzzle picture
2092: Revisiting Puzzle 97: Pig
Status: Closed

Summary

Name: 2092: Revisiting Puzzle 97: Pig
Status: Closed
Created: 01/06/2022
Points: 100
Expired: 01/13/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science11,199100
2Beta Folders11,18674
3Anthropic Dreams11,12354
4Marvin's bunch11,09538
5Contenders10,75827

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 58 min 23 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
crashing boar
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons