puzzle picture
2089: Revisiting Puzzle 96: Collagen
Status: Closed

Summary

Name: 2089: Revisiting Puzzle 96: Collagen
Status: Closed
Created: 12/29/2021
Points: 100
Expired: 01/06/2022 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small domain is a component of the collagen that forms the connective tissue beneath your skin! This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with puzzles that are still scientifically relevant.

Sequence:
TDICKLPKDEGTCRDFILKWYYDPNTKSCARFWYGGCGGNENKFGSQKECEKVCA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,284
2Marvin's bunch10,162
3Gargleblasters10,132
4L'Alliance Francophone10,120
5Anthropic Dreams10,051

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 25 min 1 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
collagen, again
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons