puzzle picture
2083: Revisiting Puzzle 94: Mouse
Status: Closed

Summary

Name: 2083: Revisiting Puzzle 94: Mouse
Status: Closed
Created: 12/16/2021
Points: 100
Expired: 12/23/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein recruits components of the immune system, and normally keeps white blood cells concentrated in the lymph nodes. However, it also plays a part in the inflammatory response, when immune cells are required to fight an infection. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been and to provide newer players with easier puzzles that are still scientifically relevant.

Sequence:
ASNYDCCLSYIQTPLPSRAIVGFTRQMADEACDINAIIFHTKKRKSVCADPKQNWVKRAVNLLSLRVKKM
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,505100
2Contenders10,47774
3Anthropic Dreams10,43554
4Marvin's bunch10,42538
5Go Science10,41227

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
Groups: Beta Folders
mouse in the house
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons