![]() |
2075: Revisiting Puzzle 91: Virus Protein
Status: Closed
|
Summary
Name: | 2075: Revisiting Puzzle 91: Virus Protein |
---|---|
Status: | Closed |
Created: | 11/25/2021 |
Points: | 100 |
Expired: | 12/02/2021 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This protein is found on the surface of bacteriophage fd, a virus that infects E. coli. It is responsible for penetrating the cell membrane of the host bacteria, allowing virus to enter the cell. This protein contains four cysteines that oxidize to form two disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been, and to provide newer players with easier puzzles that are still scientifically relevant.
Sequence:
ETVESCLAKPHTENSFTNVWKDDKTLDRYANYEGCLWNATGVVVCTGDETQCYGTWVPIGLAIPENAAAH
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/91:_Virus_Protein