puzzle picture
2072: Revisiting Puzzle 90: Heliomicin
Status: Closed

Summary

Name: 2072: Revisiting Puzzle 90: Heliomicin
Status: Closed
Created: 11/18/2021
Points: 100
Expired: 11/25/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Contenders9,788100
2Go Science9,78670
3Beta Folders9,74847
4L'Alliance Francophone9,71930
5Anthropic Dreams9,70319

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 47 min 24 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
chime in, oil
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons