![]() |
2072: Revisiting Puzzle 90: Heliomicin
Status: Closed
|
Summary
Name: | 2072: Revisiting Puzzle 90: Heliomicin |
---|---|
Status: | Closed |
Created: | 11/18/2021 |
Points: | 100 |
Expired: | 11/25/2021 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This small disulfide-rich protein is produced by the moth H. virescens as a defense against certain bacterial and fungal infections. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence: DKLIGSCVWGAVNYTSDCNGECKRRGYKGGHCGSFANVNCWCET |
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/90:_Heliomicin