puzzle picture
2051: Revisiting Puzzle 84: Giant Anemone
Status: Closed

Summary

Name: 2051: Revisiting Puzzle 84: Giant Anemone
Status: Closed
Created: 09/30/2021
Points: 100
Expired: 10/07/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin, which is released by the sea anemone A. xanthogrammica, disrupts normal contraction of cardiac muscle in potential predators, and furthermore serves as a pheromone to signal danger to nearby anemones. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
GVSCLCDSDGPSVRGNTLSGTLWLYPSGCPSGWHNCKAHGPTIGWCCKQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders9,891100
2Anthropic Dreams9,87580
3Contenders9,82963
4Go Science9,80549
5Gargleblasters9,75837

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Joined: 12/27/2012
Groups: Beta Folders
anemone of my anemone is my frenome
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons