puzzle picture
2048: Revisiting Puzzle 83: Cardiotoxin
Status: Closed

Summary

Name: 2048: Revisiting Puzzle 83: Cardiotoxin
Status: Closed
Created: 09/23/2021
Points: 100
Expired: 09/30/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Chinese cobra N. atra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
LKCNKLVPLFYKTCPAGKNLCYKMFMVSNLTVPVKRGCIDVCPKNSALVKYVCCNTDRCN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,428100
2Gargleblasters10,37676
3Go Science10,33656
4Anthropic Dreams10,31541
5Marvin's bunch10,21729

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 42 min 48 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
cardi t
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons