puzzle picture
2045: Revisiting Puzzle 82: Cytotoxin
Status: Closed

Summary

Name: 2045: Revisiting Puzzle 82: Cytotoxin
Status: Closed
Created: 09/16/2021
Points: 100
Expired: 09/23/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Gargleblasters10,443100
2Anthropic Dreams10,42471
3Beta Folders10,41649
4Marvin's bunch10,30733
5Go Science10,30222

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 32 min 22 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
nervous and temperamental
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons