puzzle picture
2042: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed

Summary

Name: 2042: Revisiting Puzzle 81: Calcium Ion Binding Protein
Status: Closed
Created: 09/09/2021
Points: 100
Expired: 09/16/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
31Weber CHM3010 F20208,9521
32Foldit Staff8,6001
33Window Group4,7341

Top Evolvers

RankPlayerGroupScorePoints
31alcor29 5 10 Anthropic Dreams10,43451
32BootsMcGraw 13 7 Contenders10,33749
33georg137 16 29 Contenders10,33148
34Holp 62 357 Ogre's lab9,77246

Top Soloists

RankPlayerGroupScorePoints
31dcrwheeler 62 8  10,35435
32ProfVince 62 50  10,34234
33Lotus23 43 49 Marvin's bunch10,33432
34WBarme1234 62 28  10,32230
35MicElephant 31 20  10,29629


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 6 hours 55 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
ion u
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons