puzzle picture
2030: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed

Summary

Name: 2030: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed
Created: 08/12/2021
Points: 100
Expired: 08/19/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Anthropic Dreams10,195100
2Go Science10,17373
3Beta Folders10,15352
4Contenders10,13536
5Marvin's bunch10,07524

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1grogar7 38 2 Anthropic Dreams10,187100
2sallallami 70 6  10,17897
3Galaxie 2 3 Anthropic Dreams10,17594
4mirp 13 20 Go Science10,15791
5LociOiling 4 1 Beta Folders10,15287


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 35 min 58 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
pouty eels
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons