![]() |
2030: Revisiting Puzzle 75: Antifreeze Protein
Status: Closed
|
Summary
Name: | 2030: Revisiting Puzzle 75: Antifreeze Protein |
---|---|
Status: | Closed |
Created: | 08/12/2021 |
Points: | 100 |
Expired: | 08/19/2021 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/75:_Antifreeze_Protein