![]() |
2028: Revisiting Puzzle 74: Platypus Venom
Status: Closed
|
Summary
Name: | 2028: Revisiting Puzzle 74: Platypus Venom |
---|---|
Status: | Closed |
Created: | 08/05/2021 |
Points: | 100 |
Expired: | 08/12/2021 - 18:00 |
Difficulty: | Novice |
Description: | This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK
|
Categories: | Overall, Prediction |
Top Groups
Top Evolvers
Top Soloists
Need this puzzle? Log in to download.
https://foldit.fandom.com/wiki/Revisiting_puzzle/74:_Platypus_Venom