puzzle picture
2028: Revisiting Puzzle 74: Platypus Venom
Status: Closed

Summary

Name: 2028: Revisiting Puzzle 74: Platypus Venom
Status: Closed
Created: 08/05/2021
Points: 100
Expired: 08/12/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science9,770100
2Marvin's bunch9,73671
3Anthropic Dreams9,72649
4Beta Folders9,71633
5L'Alliance Francophone9,60422

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 19 min 15 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
playtpi
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons