puzzle picture
2016: Revisiting Puzzle 70: Nucleosome Protein
Status: Closed

Summary

Name: 2016: Revisiting Puzzle 70: Nucleosome Protein
Status: Closed
Created: 07/08/2021
Points: 100
Expired: 07/15/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders10,957100
2Anthropic Dreams10,94970
3Go Science10,94547
4L'Alliance Francophone10,72430
5Marvin's bunch10,71519

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 7 hours 11 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
the mighty, mighty his-tones
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, RosettaCommons