puzzle picture
2013: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed

Summary

Name: 2013: Revisiting Puzzle 69: Scorpion Toxin
Status: Closed
Created: 07/01/2021
Points: 100
Expired: 07/08/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This is another potent neurotoxin produced by scorpions, similar to that found in Puzzle 55. This protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
MKKNGYPLDRNGKTTECSGVNAIAPHYCNSECTKVYYAESGYCCWGACYCFGLEDDKPIGPMKDITKKYCDVQI
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Beta Folders11,028100
2Anthropic Dreams10,92173
3Marvin's bunch10,89652
4Go Science10,86636
5L'Alliance Francophone10,68324

Top Evolvers

Top Soloists



Need this puzzle? Log in to download.  

Comments

Vincera's picture
User offline. Last seen 1 day 5 hours ago. Offline
Joined: 02/14/2010
Groups: Nessun Dorma
Bridge Wiggle Formatting

Greetings, All.
Need some guidance on P2013: How do I know which Bridge Wiggle format to select since the Description denotes a Revisit of P69 but references P55;
AND
P1961 revisits P57 but is based on P55;
AND
P1532 is based on P69;
AND
P1077 is based on P69.

- all with varying BWs.

Vincera's picture
User offline. Last seen 1 day 5 hours ago. Offline
Joined: 02/14/2010
Groups: Nessun Dorma
Disregard

Decided to commence w 74 segs.

LociOiling's picture
User offline. Last seen 5 hours 6 min ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
scorpions again

We've had a few of these scorpion toxins, with different configurations.

The unofficial cheat sheet for this is: https://foldit.fandom.com/wiki/Revisiting_puzzle/69:_Scorpion_Toxin

The bridges for this puzzle in Bridge Wiggle format are:

17,43 28,48 32,50 44,70

Your mileage may vary; some have had success with different bridge configurations on some of these puzzles. Also, for me, Bridge Wiggle has been less successful at wiggling recently. The banding feature can still be helpful. In some cases, I've been able to band, then form bridges by dragging the cysteines closer.

Vincera's picture
User offline. Last seen 1 day 5 hours ago. Offline
Joined: 02/14/2010
Groups: Nessun Dorma
Thanx ever so much, Loci. I

Thanx ever so much, Loci. I commenced with this same Hottentotta format but may not end with it. I did retain your Fandom notes from the Beta-Neurotoxin puzzle that you helped me with in February past. Much appreciation!

User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons