puzzle picture
2010: Revisiting Puzzle 68: Bos Taurus
Status: Closed

Summary

Name: 2010: Revisiting Puzzle 68: Bos Taurus
Status: Closed
Created: 06/24/2021
Points: 100
Expired: 07/01/2021 - 18:00
Difficulty: Novice
Description: This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ
Categories: Overall, Prediction

Top Groups

RankGroupScorePoints
1Go Science10,736100
2Beta Folders10,71771
3Contenders10,70549
4L'Alliance Francophone10,62133
5Anthropic Dreams10,60922

Top Evolvers

Top Soloists

RankPlayerGroupScorePoints
1Bruno Kestemont 3 4 Go Science10,736100
2LociOiling 4 2 Beta Folders10,71397
3Bletchley Park 10 32 Contenders10,70593
4dcrwheeler 71 6  10,66590
5johnmitch 71 7  10,64486


Need this puzzle? Log in to download.  

Comments

LociOiling's picture
User offline. Last seen 57 min 13 sec ago. Offline
Joined: 12/27/2012
Groups: Beta Folders
moo
User login
Download links:
  Windows    OSX    Linux  
Windows
(7/8/10)
OSX
(10.12 or later)
Linux
(64-bit)

Are you new to Foldit? Click here.

Are you a student? Click here.

Are you an educator? Click here.
Social Media


Search
Only search fold.it
Other Games: Mozak
Recommend Foldit
Topics
Top New Users
Sitemap

Developed by: UW Center for Game Science, UW Institute for Protein Design, Northeastern University, Vanderbilt University Meiler Lab, UC Davis
Supported by: DARPA, NSF, NIH, HHMI, Amazon, Microsoft, Adobe, Boehringer Ingelheim, RosettaCommons